PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G083400.1
Common NameB456_002G083400, LOC105780295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 78aa    MW: 8886.63 Da    PI: 3.9191
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G083400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.7e-102971246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        + ++++E+ l ++ +++ G + W +Ia +++ gRt++++  +w++
  Gorai.002G083400.1 29 LQFSEDEETLVIRMFNLVGER-WGLIAGRIP-GRTAEEIEKYWNT 71
                        579******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.7E-72775IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-133072IPR009057Homeodomain-like
SuperFamilySSF466891.17E-83073IPR009057Homeodomain-like
PfamPF002491.2E-93071IPR001005SANT/Myb domain
CDDcd001674.22E-83171No hitNo description
PROSITE profilePS500906.9343173IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MAESEYSSSE NASMDSDSIE DQSKQDLELQ FSEDEETLVI RMFNLVGERW GLIAGRIPGR  60
TAEEIEKYWN TRYSTSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459994.14e-50PREDICTED: MYB-like transcription factor ETC1
SwissprotQ9LNI52e-16ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLA0A0D2Q2P74e-50A0A0D2Q2P7_G
STRINGVIT_10s0116g00500.t013e-32(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.13e-17MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]